General Information

  • ID:  hor004192
  • Uniprot ID:  Q9TSZ0
  • Protein name:  Angiotensin-4
  • Gene name:  AGT
  • Organism:  Callithrix jacchus (White-tufted-ear marmoset)
  • Family:  Serpin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Callithrix (subgenus), Callithrix (genus), Callitrichinae (subfamily), Cebidae (family), Platyrrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004867 serine-type endopeptidase inhibitor activity
  • GO BP:  GO:0003081 regulation of systemic arterial blood pressure by renin-angiotensin; GO:0010718 positive regulation of epithelial to mesenchymal transition; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance; GO:1901394 positive regulation of transforming growth factor beta1 activation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  VYIHPF
  • Length:  6
  • Propeptide:  MPPASMSLRVTILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEELAKANAGKPEDPTFTPALIQAKSLPVDEKALQDQLVLVAAKLNAEDKLRAATVGMLANFLSFHIYSMHSELWGMVQGATILSPMAVFGTLASLYLGASNHTAYRLQAILGVPWKDENCTSRLDAHKVLSALQAVQGLLVAQDRAEGQTQLLLSTVVGLFTAPGLHLKQPFVQGLALYAPAVLPRSLDFSTDLDVAAEKIDRFMQAVTGWKVSSPLTGASADSNLVFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDAQDKFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMNKLSPRAIHLTMPRLVLRGSYDLQDLLAQAELPTILGTELNLQKMSNNNLRVGKVLNSIFFELEADEKEPTESTQQPKGPEVLELNLNHPFLFAVYDQDATALYFLGRVANPLTTV
  • Signal peptide:  MPPASMSLRVTILCLLAWAGLAAG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  AGTR2
  • Target Unid:  F6Q2S1
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81172-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P81172-F1.pdbhor004192_AF2.pdbhor004192_ESM.pdb

Physical Information

Mass: 86428 Formula: C40H54N8O8
Absent amino acids: ACDEGKLMNQRSTW Common amino acids: FHIPVY
pI: 7.54 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: 90 Boman Index: 714
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 113.33
Instability Index: 4363.33 Extinction Coefficient cystines: 1490
Absorbance 280nm: 298

Literature

  • PubMed ID:  10598135
  • Title:  Cloning and Characterization of Marmoset Renin: Comparison With Human Renin